Affiliate offer

z-needs domain VSL - Erase Back Pain (ALL GEOS)

$37.00 CTC Back to Life 3 level healthy back/ fit body system with 60 day guarantee

Offer details

CategoryNutra
CPA payout$22.00 · EPC $9.99
Target GEOs
ADAEAFAGAIALAMANAOAQARASATAUAWAXAZBA+232 GEOs
Show all accepted GEOs
ADAEAFAGAIALAMANAOAQARASATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBOBQBRBSBTBVBWBYBZCACCCDCFCGCHCICKCLCMCNCOCRCUCVCWCXCYCZDEDJDKDMDODZECEEEGEHERESETFIFJFKFMFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGUGWGYHKHMHNHRHTHUIDIEILIMINIOIQIRISITJEJMJOJPKEKGKHKIKMKNKPKRKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMDMEMFMGMHMKMLMMMNMOMPMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPRPSPTPWPYQARERORSRURWSASBSCSDSESGSHSISJSKSLSMSNSOSRSSSTSVSXSYSZTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWTZUAUGUMUSUYUZVAVCVEVGVIVNVUWFWSYEYTZAZMZW

Full GEO list remains available in the dashboard after approval.

Traffic sources
ContextualDisplay BannerEmailEmail - NewsltrFacebookGoogle - GDNLinkoutNativeNetworkOther+6 sources

How to request and run this offer

  1. Create your Cash Nutra affiliate account.
  2. Request access from your member dashboard.
  3. Launch only after approval and tracking validation.
AccessApproval required
Target GEOs250 GEOs covered
Traffic sources16 sources

Frequently asked questions

How do I access this offer?

Create an affiliate account and request access from the Cash Nutra member dashboard. Access depends on traffic quality, GEO fit and campaign availability.

Which traffic sources are accepted?

Use only the traffic sources displayed on this page and confirm final restrictions with your affiliate manager before launch.

Is the payout guaranteed?

The displayed CPA is indicative of the current public listing and can change by GEO, traffic quality, volume or advertiser conditions.

Cash Nutra. Campaign availability, payout and restrictions may change. Always use the current terms shown in your Cash Nutra dashboard.

Apply as an affiliate ->